PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00129368001
Common NameGSBRNA2T00129368001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB_related
Protein Properties Length: 1611aa    MW: 176663 Da    PI: 7.2232
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00129368001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.41.1e-10855896346
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          +WT+eE e ++   +++G++ +k+Ia+ +   +t  +c+++++k
  GSBRNA2T00129368001 855 PWTPEEKETFLSMLAMHGKD-FKKIASFLT-QKTTADCIDYYYK 896
                          8*****************99.********9.9**********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.2E-14838899IPR009057Homeodomain-like
PROSITE profilePS5129315.246851902IPR017884SANT domain
SMARTSM007171.6E-9852900IPR001005SANT/Myb domain
PfamPF002493.2E-9854896IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-7855901IPR009057Homeodomain-like
CDDcd001674.74E-8855897No hitNo description
PROSITE profilePS5129310.13110651116IPR017884SANT domain
SMARTSM007172.5E-510661114IPR001005SANT/Myb domain
SuperFamilySSF466891.09E-710691116IPR009057Homeodomain-like
CDDcd001676.43E-510701111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1611 aa     Download sequence    Send to blast
MPPQDHSSWD RKDLLRQRKH ERPSEPPFDP PPFRWRDSPS SSSSSHREFS RWGGSADFRR  60
PSSHGKQGGR YQFVEESSHG YTSSRSSARM FENDYYRPSA PRGDWRYTRN CRDDRVPLSQ  120
KDWRSNTWEM NNGSYRAFDR PCGVRNGRRS VEERPPPASD THTTVVNSWE QANSAQQMDI  180
ELCTPSRTVR SKNEQKFLDQ RQSLPSDPHS EGLGLLDRPS SVNSYENKEC SPAKQSNGLM  240
HGRRLAGDNA SDPPILNAGI EGTRNQILLK DMHDTKLHEV SDLDGVRENG KENSLGAIGK  300
LPVWTRSGSF ASQSSGFSHS SSLKSLGAVD SSDGKHKILP KTVAVTQSSS GDVTACPKTT  360
VSEEMSSRKK QRLGWGEGLA KYENKKVDVN TTEDGTDLLE NSAEEIHSLN KNTADKSPTA  420
ANAPDYGSPT TPSSVACNSS PDKSSAKAAI GASDVSNVCR SPSPVSSIHL ERLPINIEEL  480
DNISMERVGC LLSELLGTDD PGTGDSSSVQ LTSMKKLLAW KGDILKAVEM AESEIDLLES  540
KHKALKLESA RQCRVVGPSS DLSEGDENVQ QEASCVLGLK AVASSVAETL VRDPVHQAVS  600
AKDPVEIFED SCREVSALPQ FLATVGSNED ILPIPSTKAD SNQETIDLSS ADDSMVSDED  660
LLCAKLLSTN KIYASESSQV FNKLLPRDFS SFDDSRFPGR CQRQFDSHVK EKIADRIELL  720
RAREKILLLQ FKAFQLAWKK DLRQLTSAKY QPKANKKTEV FPYAKNGGHL KLSQPVRLRL  780
SSSAQRRDSV ASTTELVSYM KKLLKNTRLK PLRDILRMPA MILDEKERVR SRFISSNGLI  840
EDPCDVEKER TMINPWTPEE KETFLSMLAM HGKDFKKIAS FLTQKTTADC IDYYYKNHKS  900
DCFAKIKKQR SFGKEGKHTY MLAPTKKWKR EMGAASLDIL GAVSIIAANA GKVASTRQTS  960
SKRITLRGCS SSSSLQHDGN YSEGYSHSFD FPRKRTLGAD VVAVGPLSSE QINSCLRTSV  1020
KSREGCNDHL KFAPAAKKPR ISHATHNENS NEDDDSCSEE SCGETGPIHW TDVERSAFIQ  1080
GFSLFGKNFA SLSRFVRTRS PDQCRVFFSK VRKCLGLECI QSGSGNVSAS ASVDNANEGG  1140
GSDLEGPCAT ESNSGICNNG VSAKIGLNTL TSPLNMNQEG ANHSGFEHVE AGLSRSEQEN  1200
GLALLRLKDG TNSEPCRDLV DINTVESHCQ AADQMNSNDL PSKDIDEGNL TPIAVSSDPL  1260
YCGSIVLSTN IVEKGSGCEG AVVPKQSSKM QDGVMQAANR TRNSGLEAEA APSSFRYPEC  1320
LHHVPIEEDL VGVSVPQGDS NCHIESELPS PLVVQTNNMG WQFSEVNLDF DRRSQVLGHV  1380
KPEQNGQLHA TSTESCQIPW ISFTQDPSRI IRSKSDLIVK AQRTGEAFSL KKCTSSATKP  1440
LTVFQKDGRS GHSRSHSFSL SDTKRLDKNG DVKLFGTVLT ADENGSKQKH NPGGSIRPSS  1500
TLSRDHETGH QYINQQHLQN VPITSYGFWD GNRIQTGLTS LPESAKLVAS YPEALTTHQK  1560
QQVVSTKEIQ LDVSGILSFG KQIEDRAEVS SGKDKGKIGG EVNGVAEAAT *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C6e-18812903393NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D6e-18812903393NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.165320.0seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00129368001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009115935.10.0PREDICTED: uncharacterized protein LOC103841164
TrEMBLA0A078CMT60.0A0A078CMT6_BRANA; BnaA09g32720D protein
STRINGBra006915.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52602744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.10.0MYB family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]